Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth Factor (AIGF), a heparin binding growth factor, which stimulates the proliferation and activation of cells that express the FGF receptors. Recombinant human FGF-8 is a 22.4kD protein containing 193aa residues.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa65-133 from human FGF8 (NP_149354) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FGF8. Species Crossreactivity: mouse and rat.