GCET2, commonly known as germinal center B cell expressed transcript 2 protein, is a 178aa protein expressed in diffuse large B cell lymphoma (DLBCL) and several germinal center (GC) like lymphoma cell lines (at protein level). It is highly expressed in normal GC lymphocytes and GC derived malignancies, as well as being present in the thymus and spleen. In B cells expression of the HGAL gene is specifically induced by interleukin 4.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human GCET2, aa1-178 (NP_689998.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human GCET2.