MTH1 converts 8-oxo-dGTP in the nucleotide pool to the monophosphate and prevents the misincorporation of 8-oxo-dGTP into DNA. MTH1 also recognizes 8-oxo-rGTP, which could incorporate into RNA during gene transcription leading to missense or nonsense protein production.
Applications
Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human NUDT1, aa1-156 (NP_002443.3).
Form
Supplied as a liquid.
Specificity
Recognizes human NUDT1.