Beta-sarcoglycan is found in normal muscle but has a differential expression in certain instances of muscular dystrophy. This antibody will help identify the presence or absence of beta-sarcoglycan.
Applications
Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
WAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVK
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa87-196 from human SGCB with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SGCB.