S14 (Thyroid Hormone Inducible Hepatic Protein) is a nuclear protein communicates the status of dietary fuels and fuel-related hormones to genes required for long-chain fatty acid synthesis. In mammary glands S14 is important for both epithelial proliferation and milk fat production. High expression of S14 in primary invasive breast cancer is predicative of recurrence. S14 also medicates the induction of lipogenesis by protestin in breast cancer cells and accelerates their growth.
Applications
Suitable for use in ELISA and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKV
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-85 from human THRSP (NP_003242) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human THRSP.