ATBF1 is a transcription factor that negatively regulates alpha fetoprotein and MYB, transactivates CDKN1A, and may be a tumor suppressor. Loss of ATBF1 is one mechanism that defines the absence of growth control in prostate cancer. Presence of the isoform ABTF1-A is correlated with better prognosis in breast cancer and may also serve as a marker of endocrine responsiveness.
Applications
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.
Recommended Dilutions
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa2811-2910 from human ZFHX3 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ZFHX3.