Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.

Western Blot: 5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher.

Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Synthetic peptide corresponding to IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP

Supplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.

Purified by Protein A affinity chromatography.

Recognizes human SLC22A1.