Applications
Suitable for use in Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (formalin-fixed paraffin): 1:200 (ABC, DAB). Boil tissue sections in 10mM citrate buffer, pH 6.0 for 10 min followed by cooling at RT for 20 min. Optimal dilutions to be determined by the researcher.
Positive Control
Human Pancreas tissue
Storage and Stability
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
Synthetic peptide corresponding to human Amylin (KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2)
Form
Supplied as a lyophilized powder. Reconstitute with sterile dH2O.
Specificity
Recognizes human Amylin.