Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Western Blot: 5ug/ml Immunohistochemistry (Paraffin): 1:2000 Requires HIER using sodium citrate buffer pH 6.0 and trypsin. Optimal dilutions to be determined by the researcher.

Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Synthetic peptide corresponding to aa4-41, DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP of human BD2.

Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with 10ul or 100ul sterile ddH2O.

Purified by Protein G affinity chromatography from cell culture supernatant.

Recognizes human BD2.