Suitable for use in Dot Blot and Western Blot. Other applications have not been tested.

Optimal dilution to be determined by the researcher.

May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile glycerol (40-50), aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Partial recombinant protein corresponding to human PDS5, Regulator of Cohesion Maintenance, Homolog B consisting of amino acids from the C-terminal portion of the protein (Sequence: QWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEEEEERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSKTPSP)

Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.

Purified by Protein G affinity chromatography from hybridoma culture supernatant

Recognizes human PDS5, Regulator of Cohesion Maintenance, Homolog B.