Suitable for use in ELISA, Immunohistochemistry and RIA. Other applications not tested.

ELISA: 1:4000 RIA: 1:2000 Immunohistochemistry (Paraffin): 1:100 Optimal dilutions to be determined by the researcher.

Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Synthetic peptide corresponding to aa62-100, SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP of human TIP 39, conjugated to KLH.

Supplied as a lyophilized powder in PBS pH 7.2. Reconstitute with 100ul sterile ddH2O.

Serum

Recognizes human TIP 39 (aa62-100). Species Crossreactivity: bovine and canine.